Lineage for d4e17a2 (4e17 A:129-254)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700163Protein automated matches [226863] (2 species)
    not a true protein
  7. 2700164Species Chicken (Gallus gallus) [TaxId:9031] [225109] (3 PDB entries)
  8. 2700166Domain d4e17a2: 4e17 A:129-254 [220144]
    Other proteins in same PDB: d4e17a3
    automated match to d1rkea2

Details for d4e17a2

PDB Entry: 4e17 (more details), 2.3 Å

PDB Description: Alpha-E-catenin is an autoinhibited molecule that co-activates vinculin
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d4e17a2:

Sequence, based on SEQRES records: (download)

>d4e17a2 a.24.9.1 (A:129-254) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsaeineiirvl
qltswd

Sequence, based on observed residues (ATOM records): (download)

>d4e17a2 a.24.9.1 (A:129-254) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttkgieealknrnftvekmsaeineiirvlqltsw
d

SCOPe Domain Coordinates for d4e17a2:

Click to download the PDB-style file with coordinates for d4e17a2.
(The format of our PDB-style files is described here.)

Timeline for d4e17a2: