SCOPe 2.08: Domain d4e13a2: 4e13 A:190-283

Lineage for d4e13a2 (4e13 A:190-283)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Acinetobacter baylyi [TaxId:202950] [226523] (3 PDB entries)

8. Domain d4e13a2: 4e13 A:190-283 [220142]
   Other proteins in same PDB: d4e13a1
   automated match to d1f17a1
   complexed with 1pe, gol, nad, so4

Details for d4e13a2

PDB Entry: 4e13, 2.08 Å

PDB Description: Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase

PDB Compounds: (A:) Diketoreductase

SCOPe Domain Sequences for d4e13a2:

Sequence; same for both SEQRES and ATOM records:

>d4e13a2 a.100.1.0 (A:190-283) automated matches {Acinetobacter baylyi [TaxId: 202950]}
gyvlnsllvplldaaaellvdgiadpetidktwrigtgapkgpfeifdivglttayniss
vsgpkqrefaaylkenyidkgklglatgegfyry

Timeline for d4e13a2:

• d4e13a2 first appeared in SCOPe 2.03
  
• d4e13a2 appears in SCOPe 2.07