SCOPe 2.04: Domain d4e0bc1: 4e0b C:0-145

Lineage for d4e0bc1 (4e0b C:0-145)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226332] (1 PDB entry)

8. Domain d4e0bc1: 4e0b C:0-145 [220131]
   Other proteins in same PDB: d4e0ba2, d4e0bb2, d4e0bc2, d4e0bd2
   automated match to d2cmda1
   complexed with act

Details for d4e0bc1

PDB Entry: 4e0b, 2.17 Å

PDB Description: 2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d4e0bc1:

Sequence, based on SEQRES records:

>d4e0bc1 c.2.1.0 (C:0-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
amkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgya
gedptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigiitn
pvnttvpiaaevlkkagvydkrklfg

Sequence, based on observed residues (ATOM records):

>d4e0bc1 c.2.1.0 (C:0-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
amkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgya
gedptpalegadvvlisagvaadlfnvnagivkslaeriavvcpnacigiitnpvnttvp
iaaevlkkagvydkrklfg

Timeline for d4e0bc1:

• d4e0bc1 first appeared in SCOPe 2.03
  
• d4e0bc1 appears in SCOPe 2.05
  
• d4e0bc1 appears in the current release, SCOPe 2.08