SCOP 1.55: Domain d1eerc1: 1eer C:8-116

Lineage for d1eerc1 (1eer C:8-116)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1eerc1: 1eer C:8-116 [22013]
   Other proteins in same PDB: d1eera_

Details for d1eerc1

PDB Entry: 1eer, 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms

SCOP Domain Sequences for d1eerc1:

Sequence; same for both SEQRES and ATOM records:

>d1eerc1 b.1.2.1 (C:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

Timeline for d1eerc1:

• d1eerc1 appears in SCOP 1.57
  
• d1eerc1 appears in the current release, SCOPe 2.08