Lineage for d4e0ba1 (4e0b A:1-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849279Species Vibrio vulnificus [TaxId:216895] [226332] (1 PDB entry)
  8. 2849280Domain d4e0ba1: 4e0b A:1-145 [220127]
    Other proteins in same PDB: d4e0ba2, d4e0ba3, d4e0bb2, d4e0bb3, d4e0bc2, d4e0bc3, d4e0bd2, d4e0bd3
    automated match to d2cmda1
    complexed with act

Details for d4e0ba1

PDB Entry: 4e0b (more details), 2.17 Å

PDB Description: 2.17 angstrom resolution crystal structure of malate dehydrogenase from vibrio vulnificus cmcp6
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4e0ba1:

Sequence, based on SEQRES records: (download)

>d4e0ba1 c.2.1.0 (A:1-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
mkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgyag
edptpalegadvvlisagvarkpgmdradlfnvnagivkslaeriavvcpnacigiitnp
vnttvpiaaevlkkagvydkrklfg

Sequence, based on observed residues (ATOM records): (download)

>d4e0ba1 c.2.1.0 (A:1-145) automated matches {Vibrio vulnificus [TaxId: 216895]}
mkvavigaaggigqalalllknrlpagsdlalydiapvtpgvaadlshipthvsikgyag
edptpalegadvvlisagvaradlfnvnagivkslaeriavvcpnacigiitnpvnttvp
iaaevlkkagvydkrklfg

SCOPe Domain Coordinates for d4e0ba1:

Click to download the PDB-style file with coordinates for d4e0ba1.
(The format of our PDB-style files is described here.)

Timeline for d4e0ba1: