SCOPe 2.08: Domain d4e04b2: 4e04 B:127-319

Lineage for d4e04b2 (4e04 B:127-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [226420] (1 PDB entry)

8. Domain d4e04b2: 4e04 B:127-319 [220126]
   Other proteins in same PDB: d4e04a1, d4e04a3, d4e04b1, d4e04b3
   automated match to d2oola1
   complexed with lbv

Details for d4e04b2

PDB Entry: 4e04, 1.79 Å

PDB Description: RpBphP2 chromophore-binding domain crystallized by homologue-directed mutagenesis.

PDB Compounds: (B:) Bacteriophytochrome (Light-regulated signal transduction histidine kinase), PhyB1

SCOPe Domain Sequences for d4e04b2:

Sequence; same for both SEQRES and ATOM records:

>d4e04b2 d.110.2.0 (B:127-319) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
rypqaffrsvrsairrlqaaetlesacaaaaqevreitgfdrvmiyrfasdfsgeviaed
rcaevesylglhfpasdipaqarrlytinpvriipdinyrpvpvtpdlnprtgrpidlsf
ailrsvspvhleymrnigmhgtmsisilrgerlwgliachhrkpnyvdlevrqacelvaq
vlawqigvmeeqa

Timeline for d4e04b2:

• d4e04b2 first appeared in SCOPe 2.03
  
• d4e04b2 appears in SCOPe 2.07