Lineage for d4e04b2 (4e04 B:127-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970292Species Rhodopseudomonas palustris [TaxId:258594] [226420] (1 PDB entry)
  8. 2970294Domain d4e04b2: 4e04 B:127-319 [220126]
    Other proteins in same PDB: d4e04a1, d4e04a3, d4e04b1, d4e04b3
    automated match to d2oola1
    complexed with lbv

Details for d4e04b2

PDB Entry: 4e04 (more details), 1.79 Å

PDB Description: RpBphP2 chromophore-binding domain crystallized by homologue-directed mutagenesis.
PDB Compounds: (B:) Bacteriophytochrome (Light-regulated signal transduction histidine kinase), PhyB1

SCOPe Domain Sequences for d4e04b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e04b2 d.110.2.0 (B:127-319) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
rypqaffrsvrsairrlqaaetlesacaaaaqevreitgfdrvmiyrfasdfsgeviaed
rcaevesylglhfpasdipaqarrlytinpvriipdinyrpvpvtpdlnprtgrpidlsf
ailrsvspvhleymrnigmhgtmsisilrgerlwgliachhrkpnyvdlevrqacelvaq
vlawqigvmeeqa

SCOPe Domain Coordinates for d4e04b2:

Click to download the PDB-style file with coordinates for d4e04b2.
(The format of our PDB-style files is described here.)

Timeline for d4e04b2: