| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
| Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
| Protein automated matches [190838] (19 species) not a true protein |
| Species Rhodopseudomonas palustris [TaxId:258594] [226420] (1 PDB entry) |
| Domain d4e04b2: 4e04 B:127-319 [220126] Other proteins in same PDB: d4e04a1, d4e04a3, d4e04b1, d4e04b3 automated match to d2oola1 complexed with lbv |
PDB Entry: 4e04 (more details), 1.79 Å
SCOPe Domain Sequences for d4e04b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e04b2 d.110.2.0 (B:127-319) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
rypqaffrsvrsairrlqaaetlesacaaaaqevreitgfdrvmiyrfasdfsgeviaed
rcaevesylglhfpasdipaqarrlytinpvriipdinyrpvpvtpdlnprtgrpidlsf
ailrsvspvhleymrnigmhgtmsisilrgerlwgliachhrkpnyvdlevrqacelvaq
vlawqigvmeeqa
Timeline for d4e04b2: