Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
Protein automated matches [190838] (7 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [226420] (1 PDB entry) |
Domain d4e04a2: 4e04 A:127-320 [220124] Other proteins in same PDB: d4e04a1, d4e04b1 automated match to d2oola1 complexed with lbv |
PDB Entry: 4e04 (more details), 1.79 Å
SCOPe Domain Sequences for d4e04a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e04a2 d.110.2.0 (A:127-320) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} rypqaffrsvrsairrlqaaetlesacaaaaqevreitgfdrvmiyrfasdfsgeviaed rcaevesylglhfpasdipaqarrlytinpvriipdinyrpvpvtpdlnprtgrpidlsf ailrsvspvhleymrnigmhgtmsisilrgerlwgliachhrkpnyvdlevrqacelvaq vlawqigvmeeqal
Timeline for d4e04a2: