Lineage for d4dzbb2 (4dzb B:118-245)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2749921Domain d4dzbb2: 4dzb B:118-245 [220122]
    Other proteins in same PDB: d4dzba1, d4dzbb1
    automated match to d1ktke2

Details for d4dzbb2

PDB Entry: 4dzb (more details), 1.7 Å

PDB Description: Mucosal-associated invariant T cell receptor, Valpha7.2Jalpha33-Vbeta2
PDB Compounds: (B:) Vbeta2 (MAIT T cell receptor)

SCOPe Domain Sequences for d4dzbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dzbb2 b.1.1.2 (B:118-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4dzbb2:

Click to download the PDB-style file with coordinates for d4dzbb2.
(The format of our PDB-style files is described here.)

Timeline for d4dzbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dzbb1