SCOPe 2.08: Domain d4dzba2: 4dzb A:111-199

Lineage for d4dzba2 (4dzb A:111-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4dzba2: 4dzb A:111-199 [220120]
   Other proteins in same PDB: d4dzba1, d4dzbb1
   automated match to d2f54d2

Details for d4dzba2

PDB Entry: 4dzb, 1.7 Å

PDB Description: Mucosal-associated invariant T cell receptor, Valpha7.2Jalpha33-Vbeta2

PDB Compounds: (A:) Valpha7.2-Jalpha33 (MAIT T cell receptor)

SCOPe Domain Sequences for d4dzba2:

Sequence, based on SEQRES records:

>d4dzba2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4dzba2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsidtffps

Timeline for d4dzba2:

• d4dzba2 first appeared in SCOPe 2.03
  
• d4dzba2 appears in SCOPe 2.07