SCOP 1.57: Domain d1eerb2: 1eer B:117-220

Lineage for d1eerb2 (1eer B:117-220)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Erythropoietin (EPO) receptor [49282] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49283] (5 PDB entries)

8. Domain d1eerb2: 1eer B:117-220 [22012]
   Other proteins in same PDB: d1eera_

Details for d1eerb2

PDB Entry: 1eer, 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms

SCOP Domain Sequences for d1eerb2:

Sequence; same for both SEQRES and ATOM records:

>d1eerb2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens)}
evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile
grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvsllt

Timeline for d1eerb2:

• d1eerb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eerb2 appears in SCOP 1.59
  
• d1eerb2 appears in the current release, SCOPe 2.08