Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Erythropoietin (EPO) receptor [49282] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
Domain d1eerb2: 1eer B:117-220 [22012] Other proteins in same PDB: d1eera_ |
PDB Entry: 1eer (more details), 1.9 Å
SCOPe Domain Sequences for d1eerb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eerb2 b.1.2.1 (B:117-220) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} evvlldapvglvarladesghvvlrwlpppetpmtshiryevdvsagqgagsvqrveile grtecvlsnlrgrtrytfavrarmaepsfggfwsewsepvsllt
Timeline for d1eerb2: