SCOPe 2.04: Domain d4dzba1: 4dzb A:1-110

Lineage for d4dzba1 (4dzb A:1-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4dzba1: 4dzb A:1-110 [220119]
   Other proteins in same PDB: d4dzba2, d4dzbb2
   automated match to d2f54d1

Details for d4dzba1

PDB Entry: 4dzb, 1.7 Å

PDB Description: Mucosal-associated invariant T cell receptor, Valpha7.2Jalpha33-Vbeta2

PDB Compounds: (A:) Valpha7.2-Jalpha33 (MAIT T cell receptor)

SCOPe Domain Sequences for d4dzba1:

Sequence; same for both SEQRES and ATOM records:

>d4dzba1 b.1.1.0 (A:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcafmdsnyqliwgagtkliikpd

Timeline for d4dzba1:

• d4dzba1 first appeared in SCOPe 2.03
  
• d4dzba1 appears in SCOPe 2.05
  
• d4dzba1 appears in the current release, SCOPe 2.08