| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries) |
| Domain d4dz6f1: 4dz6 F:3-169 [220114] Other proteins in same PDB: d4dz6a2, d4dz6b2, d4dz6c2, d4dz6d2, d4dz6e2, d4dz6f2 automated match to d1xqia1 complexed with adp, edo, vn4, vo4 |
PDB Entry: 4dz6 (more details), 2.2 Å
SCOPe Domain Sequences for d4dz6f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dz6f1 d.58.6.0 (F:3-169) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfrh
seavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfkys
nekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc
Timeline for d4dz6f1: