Lineage for d4dz6d1 (4dz6 D:3-169)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951774Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries)
  8. 2951778Domain d4dz6d1: 4dz6 D:3-169 [220112]
    Other proteins in same PDB: d4dz6a2, d4dz6b2, d4dz6c2, d4dz6d2, d4dz6e2, d4dz6f2
    automated match to d1xqia1
    complexed with adp, edo, vn4, vo4

Details for d4dz6d1

PDB Entry: 4dz6 (more details), 2.2 Å

PDB Description: transition state mimic of nucleoside-diphosphate kinase from borrelia burgdorferi with bound vanadate and adp
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4dz6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dz6d1 d.58.6.0 (D:3-169) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfrh
seavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfkys
nekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc

SCOPe Domain Coordinates for d4dz6d1:

Click to download the PDB-style file with coordinates for d4dz6d1.
(The format of our PDB-style files is described here.)

Timeline for d4dz6d1: