![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Erythropoietin (EPO) receptor [49282] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries) |
![]() | Domain d1eerb1: 1eer B:8-116 [22011] Other proteins in same PDB: d1eera_ |
PDB Entry: 1eer (more details), 1.9 Å
SCOPe Domain Sequences for d1eerb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eerb1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin
Timeline for d1eerb1: