Lineage for d1eerb1 (1eer B:8-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761758Protein Erythropoietin (EPO) receptor [49282] (1 species)
  7. 2761759Species Human (Homo sapiens) [TaxId:9606] [49283] (6 PDB entries)
  8. 2761760Domain d1eerb1: 1eer B:8-116 [22011]
    Other proteins in same PDB: d1eera_

Details for d1eerb1

PDB Entry: 1eer (more details), 1.9 Å

PDB Description: crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms
PDB Compounds: (B:) erythropoietin receptor

SCOPe Domain Sequences for d1eerb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eerb1 b.1.2.1 (B:8-116) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]}
dpkfeskaallaargpeellcfterledlvcfweeaasagvgpgqysfsyqledepwklc
rlhqaptargavrfwcslptadtssfvplelrvtaasgapryhrvihin

SCOPe Domain Coordinates for d1eerb1:

Click to download the PDB-style file with coordinates for d1eerb1.
(The format of our PDB-style files is described here.)

Timeline for d1eerb1: