| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Acinetobacter baylyi [TaxId:202950] [226523] (3 PDB entries) |
| Domain d4dyda2: 4dyd A:190-283 [220105] Other proteins in same PDB: d4dyda1 automated match to d1f17a1 complexed with gol, nad, po4, so4 |
PDB Entry: 4dyd (more details), 1.95 Å
SCOPe Domain Sequences for d4dyda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dyda2 a.100.1.0 (A:190-283) automated matches {Acinetobacter baylyi [TaxId: 202950]}
gyvlnsllvplldaaaellvdgiadpetidktwrigtgapkgpfeifdivglttayniss
vsgpkqrefaaylkenyidkgklglatgegfyry
Timeline for d4dyda2: