SCOP 1.59: Domain d1hwhb2: 1hwh B:131-237

Lineage for d1hwhb2 (1hwh B:131-237)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)

8. Domain d1hwhb2: 1hwh B:131-237 [22010]
   Other proteins in same PDB: d1hwha_

Details for d1hwhb2

PDB Entry: 1hwh, 2.9 Å

PDB Description: 1:1 complex of human growth hormone mutant g120r with its soluble binding protein

SCOP Domain Sequences for d1hwhb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwhb2 b.1.2.1 (B:131-237) Growth hormone receptor {Human (Homo sapiens)}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqms

Timeline for d1hwhb2:

• d1hwhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwhb2 appears in SCOP 1.57
  
• d1hwhb2 appears in SCOP 1.61
  
• d1hwhb2 appears in the current release, SCOPe 2.08