| Class b: All beta proteins [48724] (180 folds) |
| Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
| Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
| Protein Alcohol dehydrogenase [50137] (9 species) contains a Zn-finger subdomain, residues 94-117 |
| Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries) Uniprot P00327 |
| Domain d4dxhb1: 4dxh B:1-163,B:340-374 [220094] Other proteins in same PDB: d4dxha2, d4dxhb2 automated match to d1heta1 complexed with etf, mrd, naj, zn |
PDB Entry: 4dxh (more details), 1.12 Å
SCOPe Domain Sequences for d4dxhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxhb1 b.35.1.2 (B:1-163,B:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf
Timeline for d4dxhb1: