![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Growth hormone receptor [49280] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries) tandem of fibronectin type III domains |
![]() | Domain d1hwhb1: 1hwh B:32-130 [22009] Other proteins in same PDB: d1hwha_ mutant |
PDB Entry: 1hwh (more details), 2.9 Å
SCOPe Domain Sequences for d1hwhb1:
Sequence, based on SEQRES records: (download)
>d1hwhb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage nscyfnssftsiwipycikltsnggtvdekcfsvdeivq
>d1hwhb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} epkftkcrsperetfschwtdpiqlfytrrntqewtqewkecpdyvsagenscyfnssft siwipycikltsnggtvdekcfsvdeivq
Timeline for d1hwhb1: