Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (8 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [226319] (2 PDB entries) |
Domain d4dxea_: 4dxe A: [220087] Other proteins in same PDB: d4dxeg_, d4dxeh_, d4dxei_, d4dxej_, d4dxek_, d4dxel_ automated match to d3hyka_ complexed with mli |
PDB Entry: 4dxe (more details), 2.51 Å
SCOPe Domain Sequences for d4dxea_:
Sequence, based on SEQRES records: (download)
>d4dxea_ d.150.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]} namihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatk eafskalgtglgkhvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleks
>d4dxea_ d.150.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]} namihgigvdlieidriqalyskqpklveriltkneqhkfnnftheqrkieflagrfatk eafskalgvafndidcyndelgkpkidyegfivhvsishtehyamsqvvleks
Timeline for d4dxea_: