Lineage for d4dxda2 (4dxd A:209-318)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries) 
Domain d4dxda2: 4dxd A:209-318 [220086]
Other proteins in same PDB: d4dxda1
automated match to d1rq2a2
complexed with 9pc, gdp
Details for d4dxda2
PDB Entry: 4dxd (more details), 2.01 Å
PDB Description: Staphylococcal Aureus FtsZ in complex with 723
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d4dxda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxda2 d.79.2.1 (A:209-318) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfddk
SCOPe Domain Coordinates for d4dxda2:
Click to download the PDB-style file with coordinates for d4dxda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dxda2:
- d4dxda2 first appeared in SCOPe 2.03
- d4dxda2 appears in SCOPe 2.06
- d4dxda2 appears in the current release, SCOPe 2.08
View in 3D
