![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [55309] (9 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries) |
![]() | Domain d4dxda2: 4dxd A:209-318 [220086] Other proteins in same PDB: d4dxda1 automated match to d1rq2a2 complexed with 9pc, gdp missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 4dxd (more details), 2.01 Å
SCOPe Domain Sequences for d4dxda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxda2 d.79.2.1 (A:209-318) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]} ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgfddk
Timeline for d4dxda2: