Lineage for d4dwxb_ (4dwx B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397249Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1397257Protein automated matches [190455] (4 species)
    not a true protein
  7. 1397272Species Secale cereale [TaxId:4550] [194813] (3 PDB entries)
  8. 1397276Domain d4dwxb_: 4dwx B: [220084]
    automated match to d4dygb_
    complexed with mes, so4, zn

Details for d4dwxb_

PDB Entry: 4dwx (more details), 1.8 Å

PDB Description: Crystal Structure of a Family GH-19 Chitinase from rye seeds
PDB Compounds: (B:) Basic endochitinase C

SCOPe Domain Sequences for d4dwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwxb_ d.2.1.1 (B:) automated matches {Secale cereale [TaxId: 4550]}
svssiishaqfdrmllhrndgacqakgfytydafvaaanafpgfgatgstdarkrdvaaf
laqtshettggwatapdgafawgycfkqergaaadyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllrnpdlvatdptvsfktalwfwmtaqapkpsshavitgkwspsg
adraagrapgfgvitniingglecghgqdsrvadrigfykrycdilgvgygdnldcynqr
pf

SCOPe Domain Coordinates for d4dwxb_:

Click to download the PDB-style file with coordinates for d4dwxb_.
(The format of our PDB-style files is described here.)

Timeline for d4dwxb_: