Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) automatically mapped to Pfam PF00182 |
Protein automated matches [190455] (4 species) not a true protein |
Species Secale cereale [TaxId:4550] [194813] (3 PDB entries) |
Domain d4dwxb_: 4dwx B: [220084] automated match to d4dygb_ complexed with mes, so4, zn |
PDB Entry: 4dwx (more details), 1.8 Å
SCOPe Domain Sequences for d4dwxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dwxb_ d.2.1.1 (B:) automated matches {Secale cereale [TaxId: 4550]} svssiishaqfdrmllhrndgacqakgfytydafvaaanafpgfgatgstdarkrdvaaf laqtshettggwatapdgafawgycfkqergaaadyctpsaqwpcapgkryygrgpiqls hnynygpagraigvdllrnpdlvatdptvsfktalwfwmtaqapkpsshavitgkwspsg adraagrapgfgvitniingglecghgqdsrvadrigfykrycdilgvgygdnldcynqr pf
Timeline for d4dwxb_: