SCOPe 2.08: Domain d4dwxa_: 4dwx A:

Lineage for d4dwxa_ (4dwx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Secale cereale [TaxId:4550] [194813] (3 PDB entries)

8. Domain d4dwxa_: 4dwx A: [220083]
   automated match to d4dygb_
   complexed with mes, so4, zn

Details for d4dwxa_

PDB Entry: 4dwx, 1.8 Å

PDB Description: Crystal Structure of a Family GH-19 Chitinase from rye seeds

PDB Compounds: (A:) Basic endochitinase C

SCOPe Domain Sequences for d4dwxa_:

Sequence; same for both SEQRES and ATOM records:

>d4dwxa_ d.2.1.1 (A:) automated matches {Secale cereale [TaxId: 4550]}
svssiishaqfdrmllhrndgacqakgfytydafvaaanafpgfgatgstdarkrdvaaf
laqtshettggwatapdgafawgycfkqergaaadyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllrnpdlvatdptvsfktalwfwmtaqapkpsshavitgkwspsg
adraagrapgfgvitniingglecghgqdsrvadrigfykrycdilgvgygdnldcynqr
pf

Timeline for d4dwxa_:

• d4dwxa_ first appeared in SCOPe 2.03
  
• d4dwxa_ appears in SCOPe 2.07