SCOPe 2.03: Domain d4dwua_: 4dwu A:

Lineage for d4dwua_ (4dwu A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (30 PDB entries)

8. Domain d4dwua_: 4dwu A: [220077]
   automated match to d1ew6a_
   complexed with cmo, hem, so4

Details for d4dwua_

PDB Entry: 4dwu, 1.44 Å

PDB Description: Carbonmonoxy dehaloperoxidase-hemoglobin A structure at 1.44 Angstrom resolution

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4dwua_:

Sequence; same for both SEQRES and ATOM records:

>d4dwua_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4dwua_:

• d4dwua_ is new in SCOPe 2.03-stable
  
• d4dwua_ appears in SCOPe 2.04
  
• d4dwua_ appears in the current release, SCOPe 2.08