SCOPe 2.05: Domain d4dwtb_: 4dwt B:

Lineage for d4dwtb_ (4dwt B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d4dwtb_: 4dwt B: [220076]
   automated match to d1ew6a_
   complexed with cmo, hem, so4

Details for d4dwtb_

PDB Entry: 4dwt, 2.05 Å

PDB Description: Carbonmonoxy dehaloperoxidase-hemoglobin A structure at 2.05 Angstrom resolution

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4dwtb_:

Sequence; same for both SEQRES and ATOM records:

>d4dwtb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4dwtb_:

• d4dwtb_ first appeared in SCOPe 2.03
  
• d4dwtb_ appears in SCOPe 2.04
  
• d4dwtb_ appears in SCOPe 2.06
  
• d4dwtb_ appears in the current release, SCOPe 2.08