SCOPe 2.08: Domain d4dwta_: 4dwt A:

Lineage for d4dwta_ (4dwt A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d4dwta_: 4dwt A: [220075]
   automated match to d1ew6a_
   complexed with cmo, hem, so4

Details for d4dwta_

PDB Entry: 4dwt, 2.05 Å

PDB Description: Carbonmonoxy dehaloperoxidase-hemoglobin A structure at 2.05 Angstrom resolution

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4dwta_:

Sequence; same for both SEQRES and ATOM records:

>d4dwta_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4dwta_:

• d4dwta_ first appeared in SCOPe 2.03
  
• d4dwta_ appears in SCOPe 2.07