Lineage for d4dwha1 (4dwh A:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299054Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1299055Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 1299073Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 1299074Species Escherichia coli [TaxId:562] [49359] (8 PDB entries)
  8. 1299077Domain d4dwha1: 4dwh A:1-121 [220060]
    Other proteins in same PDB: d4dwha2, d4dwhc2
    automated match to d1bf8a1
    complexed with peg, pg4, pge, po4

Details for d4dwha1

PDB Entry: 4dwh (more details), 2.5 Å

PDB Description: structure of the major type 1 pilus subunit fima bound to the fimc (2.5 a resolution)
PDB Compounds: (A:) chaperone protein fimc

SCOPe Domain Sequences for d4dwha1:

Sequence, based on SEQRES records: (download)

>d4dwha1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

Sequence, based on observed residues (ATOM records): (download)

>d4dwha1 b.1.11.1 (A:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpakla

SCOPe Domain Coordinates for d4dwha1:

Click to download the PDB-style file with coordinates for d4dwha1.
(The format of our PDB-style files is described here.)

Timeline for d4dwha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dwha2