Lineage for d3hhrb2 (3hhr B:131-234)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54832Protein Growth hormone receptor [49280] (1 species)
  7. 54833Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)
  8. 54843Domain d3hhrb2: 3hhr B:131-234 [22006]
    Other proteins in same PDB: d3hhra_

Details for d3hhrb2

PDB Entry: 3hhr (more details), 2.8 Å

PDB Description: human growth hormone and extracellular domain of its receptor: crystal structure of the complex

SCOP Domain Sequences for d3hhrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhrb2 b.1.2.1 (B:131-234) Growth hormone receptor {Human (Homo sapiens)}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlp

SCOP Domain Coordinates for d3hhrb2:

Click to download the PDB-style file with coordinates for d3hhrb2.
(The format of our PDB-style files is described here.)

Timeline for d3hhrb2: