Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (30 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226483] (2 PDB entries) |
Domain d4dvhb2: 4dvh B:89-201 [220054] Other proteins in same PDB: d4dvha1, d4dvhb1 automated match to d1jr9a2 complexed with fe |
PDB Entry: 4dvh (more details), 2.23 Å
SCOPe Domain Sequences for d4dvhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvhb2 d.44.1.0 (B:89-201) automated matches {Trypanosoma cruzi [TaxId: 353153]} ngkampkslesavtaqfgsveqfkdafvqagvnnfgsgwtwlcvdpsnknqlvidntsna gcpltkglrpvlavdvwehayykdfenrrpdylkeiwsvidwefvakmhaqai
Timeline for d4dvhb2: