Lineage for d4dvha1 (4dvh A:0-88)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476277Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1476544Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1476545Protein automated matches [226859] (26 species)
    not a true protein
  7. 1476669Species Trypanosoma cruzi [TaxId:353153] [226482] (2 PDB entries)
  8. 1476670Domain d4dvha1: 4dvh A:0-88 [220051]
    Other proteins in same PDB: d4dvha2, d4dvhb2
    automated match to d1jr9a1
    complexed with fe

Details for d4dvha1

PDB Entry: 4dvh (more details), 2.23 Å

PDB Description: Crystal structure of Trypanosoma cruzi mitochondrial iron superoxide dismutase
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4dvha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dvha1 a.2.11.0 (A:0-88) automated matches {Trypanosoma cruzi [TaxId: 353153]}
hapaelpklgfnwkdgcapvfsprqmelhytkhhkayvdklnalagttydgksieeiila
vandaekkglfnqaaqhfnhtfyfrcitp

SCOPe Domain Coordinates for d4dvha1:

Click to download the PDB-style file with coordinates for d4dvha1.
(The format of our PDB-style files is described here.)

Timeline for d4dvha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dvha2