Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226210] (3 PDB entries) |
Domain d4dvga_: 4dvg A: [220050] automated match to d2atxa1 complexed with gsp, mg |
PDB Entry: 4dvg (more details), 2.6 Å
SCOPe Domain Sequences for d4dvga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dvga_ c.37.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} lkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilhlwdtagqee ydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvglkvdlrkdg sddvtkqegddlcqklgcvayieassvakiglnevfeksvdcif
Timeline for d4dvga_: