Lineage for d3hhrb1 (3hhr B:32-130)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105341Protein Growth hormone receptor [49280] (1 species)
  7. 105342Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)
  8. 105351Domain d3hhrb1: 3hhr B:32-130 [22005]
    Other proteins in same PDB: d3hhra_

Details for d3hhrb1

PDB Entry: 3hhr (more details), 2.8 Å

PDB Description: human growth hormone and extracellular domain of its receptor: crystal structure of the complex

SCOP Domain Sequences for d3hhrb1:

Sequence, based on SEQRES records: (download)

>d3hhrb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records): (download)

>d3hhrb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdevhhgpiqlfytrrntewtqewkecpdyvsagenscyfn
ssftsiwipycikltsnggtvdekcfsvdeivq

SCOP Domain Coordinates for d3hhrb1:

Click to download the PDB-style file with coordinates for d3hhrb1.
(The format of our PDB-style files is described here.)

Timeline for d3hhrb1: