Lineage for d3hhrb1 (3hhr B:32-130)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2359190Protein Growth hormone receptor [49280] (1 species)
  7. 2359191Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 2359200Domain d3hhrb1: 3hhr B:32-130 [22005]
    Other proteins in same PDB: d3hhra_

Details for d3hhrb1

PDB Entry: 3hhr (more details), 2.8 Å

PDB Description: human growth hormone and extracellular domain of its receptor: crystal structure of the complex
PDB Compounds: (B:) HUMAN GROWTH HORMONE RECEPTOR (hGHbp)

SCOPe Domain Sequences for d3hhrb1:

Sequence, based on SEQRES records: (download)

>d3hhrb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records): (download)

>d3hhrb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
epkftkcrsperetfschwtdevhhgpiqlfytrrntewtqewkecpdyvsagenscyfn
ssftsiwipycikltsnggtvdekcfsvdeivq

SCOPe Domain Coordinates for d3hhrb1:

Click to download the PDB-style file with coordinates for d3hhrb1.
(The format of our PDB-style files is described here.)

Timeline for d3hhrb1: