Lineage for d4dvbl2 (4dvb L:109-215)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518119Domain d4dvbl2: 4dvb L:109-215 [220049]
    Other proteins in same PDB: d4dvbb1, d4dvbl1
    automated match to d1tqbc2
    complexed with pg4, so4

Details for d4dvbl2

PDB Entry: 4dvb (more details), 1.93 Å

PDB Description: The crystal structure of the Fab fragment of pro-uPA antibody mAb-112
PDB Compounds: (L:) Fab fragment of pro-uPA antibody mAb-112

SCOPe Domain Sequences for d4dvbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dvbl2 b.1.1.2 (L:109-215) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d4dvbl2:

Click to download the PDB-style file with coordinates for d4dvbl2.
(The format of our PDB-style files is described here.)

Timeline for d4dvbl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dvbl1