Lineage for d4dutb_ (4dut B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951451Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)
  8. 2951457Domain d4dutb_: 4dut B: [220044]
    automated match to d4hr2b_
    complexed with cl, so4

Details for d4dutb_

PDB Entry: 4dut (more details), 2.5 Å

PDB Description: The structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4dutb_:

Sequence, based on SEQRES records: (download)

>d4dutb_ d.58.6.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffkd
lvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsdap
etarveiafffpemnvysr

Sequence, based on observed residues (ATOM records): (download)

>d4dutb_ d.58.6.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyakdlvefmisg
pvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsdapetarveia
fffpemnvysr

SCOPe Domain Coordinates for d4dutb_:

Click to download the PDB-style file with coordinates for d4dutb_.
(The format of our PDB-style files is described here.)

Timeline for d4dutb_: