SCOPe 2.08: Domain d4duta_: 4dut A:

Lineage for d4duta_ (4dut A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)

8. Domain d4duta_: 4dut A: [220043]
   automated match to d4hr2b_
   complexed with cl, so4

Details for d4duta_

PDB Entry: 4dut, 2.5 Å

PDB Description: The structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4duta_:

Sequence; same for both SEQRES and ATOM records:

>d4duta_ d.58.6.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
alertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffk
dlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsda
petarveiafffpemnvysr

Timeline for d4duta_:

• d4duta_ first appeared in SCOPe 2.03
  
• d4duta_ appears in SCOPe 2.07