Lineage for d1a22b2 (1a22 B:329-437)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105341Protein Growth hormone receptor [49280] (1 species)
  7. 105342Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)
  8. 105346Domain d1a22b2: 1a22 B:329-437 [22004]
    Other proteins in same PDB: d1a22a_

Details for d1a22b2

PDB Entry: 1a22 (more details), 2.6 Å

PDB Description: human growth hormone bound to single receptor

SCOP Domain Sequences for d1a22b2:

Sequence, based on SEQRES records: (download)

>d1a22b2 b.1.2.1 (B:329-437) Growth hormone receptor {Human (Homo sapiens)}
vqpdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkm
mdpilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqms

Sequence, based on observed residues (ATOM records): (download)

>d1a22b2 b.1.2.1 (B:329-437) Growth hormone receptor {Human (Homo sapiens)}
vqpdppialnwtllngihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmdpi
lttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqms

SCOP Domain Coordinates for d1a22b2:

Click to download the PDB-style file with coordinates for d1a22b2.
(The format of our PDB-style files is described here.)

Timeline for d1a22b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a22b1
View in 3D
Domains from other chains:
(mouse over for more information)
d1a22a_