Lineage for d4du5c_ (4du5 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137831Species Polaromonas sp. [TaxId:296591] [226331] (1 PDB entry)
  8. 2137834Domain d4du5c_: 4du5 C: [220035]
    automated match to d3ljsa_
    complexed with cl

Details for d4du5c_

PDB Entry: 4du5 (more details), 2.7 Å

PDB Description: crystal structure of pfkb protein from polaromonas sp. js666
PDB Compounds: (C:) PfkB

SCOPe Domain Sequences for d4du5c_:

Sequence, based on SEQRES records: (download)

>d4du5c_ c.72.1.0 (C:) automated matches {Polaromonas sp. [TaxId: 296591]}
aldvitfgeammllvadrpgplehaeafhkrtagaetnvaiglarlglkvgwasrlgtds
mgryllaamaaegidcshvvcdatqktgfqfkgkvtdgsdppveyhrkgsaashmgvadi
deawllsarhlhatgvfpaisattlpaarktmdlmraagrsvsfdpnlrptlwatpelmr
daindlatradwvlpgmeegrfltgettpegvarfyrqlgaklvvvklgaegayfdgeag
sgrvagfpvaevvdtvgagdgfavgvisalldglgvpeavkrgawigaravqvlgdsegl
ptraelnaa

Sequence, based on observed residues (ATOM records): (download)

>d4du5c_ c.72.1.0 (C:) automated matches {Polaromonas sp. [TaxId: 296591]}
aldvitfgeammllvadrpgplehaeafhkrtagaetnvaiglarlglkvgwasrlgtds
mgryllaamaaegidcshvvcdatqktgfqfkgkvtddppveyhrkgsaashmgvadide
awllsarhlhatgvfpaisattlpaarktmdlmraagrsvsfdpnlrptlwatpelmrda
indlatradwvlpgmeegrfltgettpegvarfyrqlgaklvvvklgaegayfdgeagsg
rvagfpvgagdgfavgvisalldglgvpeavkrgawigaravqglptraelnaa

SCOPe Domain Coordinates for d4du5c_:

Click to download the PDB-style file with coordinates for d4du5c_.
(The format of our PDB-style files is described here.)

Timeline for d4du5c_: