SCOPe 2.08: Domain d4dt2d2: 4dt2 D:121-432

Lineage for d4dt2d2 (4dt2 D:121-432)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)

6. Protein automated matches [190524] (2 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries)

8. Domain d4dt2d2: 4dt2 D:121-432 [220017]
   Other proteins in same PDB: d4dt2a1, d4dt2b1, d4dt2c1, d4dt2d1
   automated match to d1kbpa2
   complexed with 0lv, act, edo, fe, gol, nag, so4, zn

Details for d4dt2d2

PDB Entry: 4dt2, 2.7 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc27209

PDB Compounds: (D:) purple acid phosphatase

SCOPe Domain Sequences for d4dt2d2:

Sequence; same for both SEQRES and ATOM records:

>d4dt2d2 d.159.1.1 (D:121-432) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst

Timeline for d4dt2d2:

• d4dt2d2 first appeared in SCOPe 2.03
  
• d4dt2d2 appears in SCOPe 2.07