Lineage for d4dsya2 (4dsy A:121-431)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998038Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins)
  6. 2998063Protein automated matches [190524] (2 species)
    not a true protein
  7. 2998064Species French bean (Phaseolus vulgaris) [TaxId:3885] [226472] (11 PDB entries)
  8. 2998073Domain d4dsya2: 4dsy A:121-431 [220003]
    Other proteins in same PDB: d4dsya1, d4dsyb1, d4dsyc1, d4dsyd1
    automated match to d1kbpa2
    complexed with 0lo, act, edo, fe, gol, nag, so4, zn

Details for d4dsya2

PDB Entry: 4dsy (more details), 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment cc24201
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d4dsya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dsya2 d.159.1.1 (A:121-431) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvdds

SCOPe Domain Coordinates for d4dsya2:

Click to download the PDB-style file with coordinates for d4dsya2.
(The format of our PDB-style files is described here.)

Timeline for d4dsya2: