SCOPe 2.06: Domain d1hwgb2: 1hwg B:131-234

Lineage for d1hwgb2 (1hwg B:131-234)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
   tandem of fibronectin type III domains

8. Domain d1hwgb2: 1hwg B:131-234 [22000]
   Other proteins in same PDB: d1hwga_

Details for d1hwgb2

PDB Entry: 1hwg, 2.5 Å

PDB Description: 1:2 complex of human growth hormone with its soluble binding protein

PDB Compounds: (B:) growth hormone binding protein

SCOPe Domain Sequences for d1hwgb2:

Sequence; same for both SEQRES and ATOM records:

>d1hwgb2 b.1.2.1 (B:131-234) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlp

Timeline for d1hwgb2:

• d1hwgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hwgb2 appears in SCOPe 2.05
  
• d1hwgb2 appears in SCOPe 2.07
  
• d1hwgb2 appears in the current release, SCOPe 2.08