Lineage for d4ds5a1 (4ds5 A:297-468)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860238Species Geobacillus kaustophilus [TaxId:235909] [226399] (6 PDB entries)
  8. 1860244Domain d4ds5a1: 4ds5 A:297-468 [219994]
    Other proteins in same PDB: d4ds5a2, d4ds5d2
    automated match to d1nk4a1
    protein/DNA complex; complexed with so4

Details for d4ds5a1

PDB Entry: 4ds5 (more details), 1.68 Å

PDB Description: Ternary complex of Bacillus DNA Polymerase I Large Fragment, DNA duplex, and rCTP in presence of Mg2+
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4ds5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ds5a1 c.55.3.0 (A:297-468) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d4ds5a1:

Click to download the PDB-style file with coordinates for d4ds5a1.
(The format of our PDB-style files is described here.)

Timeline for d4ds5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ds5a2