SCOP 1.59: Domain d1hwgb1: 1hwg B:32-130

Lineage for d1hwgb1 (1hwg B:32-130)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)

8. Domain d1hwgb1: 1hwg B:32-130 [21999]
   Other proteins in same PDB: d1hwga_

Details for d1hwgb1

PDB Entry: 1hwg, 2.5 Å

PDB Description: 1:2 complex of human growth hormone with its soluble binding protein

SCOP Domain Sequences for d1hwgb1:

Sequence, based on SEQRES records:

>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdevhhgtknlgpiqlfytrrntqewtqewkecpdyvsage
nscyfnssftsiwipycikltsnggtvdekcfsvdeivq

Sequence, based on observed residues (ATOM records):

>d1hwgb1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens)}
epkftkcrsperetfschwtdepiqlfytrrntqewtqewkecpdyvsagenscyfnssf
tsiwipycikltsnggtvdekcfsvdeivq

Timeline for d1hwgb1:

• d1hwgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwgb1 appears in SCOP 1.57
  
• d1hwgb1 appears in SCOP 1.61
  
• d1hwgb1 appears in the current release, SCOPe 2.08