Lineage for d4ds3a_ (4ds3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129260Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2129261Protein automated matches [191110] (11 species)
    not a true protein
  7. 2129279Species Brucella melitensis [TaxId:224914] [226345] (1 PDB entry)
  8. 2129280Domain d4ds3a_: 4ds3 A: [219989]
    automated match to d3tqra_
    complexed with cl, gol, so4

Details for d4ds3a_

PDB Entry: 4ds3 (more details), 1.85 Å

PDB Description: Crystal Structure of Phosphoribosylglycinamide formyltransferase from Brucella melitensis
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d4ds3a_:

Sequence, based on SEQRES records: (download)

>d4ds3a_ c.65.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
krnrvvifisgggsnmealiraaqapgfpaeivavfsdkaeagglakaeaagiatqvfkr
kdfaskeahedailaaldvlkpdiiclagymrllsgrfiapyegrilnihpsllplfpgl
hthqraldagmklagctvhlvtegmdegpilaqaavpvldgdtaetlaarvlkaehrlyp
lalqkfaagekasnqfsdgmvlsa

Sequence, based on observed residues (ATOM records): (download)

>d4ds3a_ c.65.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
krnrvvifisgggsnmealiraaqapgfpaeivavfsdkaeagglakaeaagiatqvfkr
kdfaskeahedailaaldvlkpdiiclagymrllsgrfiapyegrilnihpsllplfpgl
hthqraldagmklagctvhlvtedegpilaqaavpvldgdtaetlaarvlkaehrlypla
lqkfaagmvlsa

SCOPe Domain Coordinates for d4ds3a_:

Click to download the PDB-style file with coordinates for d4ds3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ds3a_: