Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Artificial gene [TaxId:32630] [193962] (5 PDB entries) |
Domain d4drxf_: 4drx F: [219988] Other proteins in same PDB: d4drxa1, d4drxa2, d4drxb1, d4drxb2, d4drxc1, d4drxc2, d4drxd1, d4drxd2 automated match to d4duia_ complexed with gtp, mg |
PDB Entry: 4drx (more details), 2.22 Å
SCOPe Domain Sequences for d4drxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4drxf_ d.211.1.1 (F:) automated matches {Artificial gene [TaxId: 32630]} dlgkklleaaragqddevrilmangadvnatdasgltplhlaatyghleivevllkhgad vnaidimgstplhlaalighleivevllkhgadvnavdtwgdtplhlaaimghleivevl lkhgadvnaqdkfgktafdisidngnedlaeilqk
Timeline for d4drxf_: