Lineage for d1axib2 (1axi B:131-236)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105341Protein Growth hormone receptor [49280] (1 species)
  7. 105342Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)
  8. 105344Domain d1axib2: 1axi B:131-236 [21998]
    Other proteins in same PDB: d1axia_

Details for d1axib2

PDB Entry: 1axi (more details), 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

SCOP Domain Sequences for d1axib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens)}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqm

SCOP Domain Coordinates for d1axib2:

Click to download the PDB-style file with coordinates for d1axib2.
(The format of our PDB-style files is described here.)

Timeline for d1axib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axib1
View in 3D
Domains from other chains:
(mouse over for more information)
d1axia_