SCOP 1.55: Domain d1axib2: 1axi B:131-236

Lineage for d1axib2 (1axi B:131-236)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (14 proteins)

6. Protein Growth hormone receptor [49280] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49281] (5 PDB entries)

8. Domain d1axib2: 1axi B:131-236 [21998]
   Other proteins in same PDB: d1axia_

Details for d1axib2

PDB Entry: 1axi, 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

SCOP Domain Sequences for d1axib2:

Sequence; same for both SEQRES and ATOM records:

>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens)}
pdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkmmd
pilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlpqm

Timeline for d1axib2:

• d1axib2 appears in SCOP 1.57
  
• d1axib2 appears in the current release, SCOPe 2.08