SCOPe 2.07: Domain d4drva1: 4drv A:64-224

Lineage for d4drva1 (4drv A:64-224)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Rotavirus sp. [TaxId:10970] [195633] (3 PDB entries)

8. Domain d4drva1: 4drv A:64-224 [219978]
   Other proteins in same PDB: d4drva2
   automated match to d4ds0a_

Details for d4drva1

PDB Entry: 4drv, 1.56 Å

PDB Description: cell attachment protein vp8* of a human rotavirus specifically interacts with a-type histo-blood group antigen

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4drva1:

Sequence; same for both SEQRES and ATOM records:

>d4drva1 b.29.1.0 (A:64-224) automated matches {Rotavirus sp. [TaxId: 10970]}
tldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvldg
qtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagttpn
asesyyltinndnsnvscdaefyliprsqtelctqyinngl

Timeline for d4drva1:

• d4drva1 first appeared in SCOPe 2.03, called d4drva_
  
• d4drva1 appears in SCOPe 2.06
  
• d4drva1 appears in the current release, SCOPe 2.08