Lineage for d4drra1 (4drr A:64-224)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781307Species Rotavirus sp. [TaxId:10970] [195633] (3 PDB entries)
  8. 2781308Domain d4drra1: 4drr A:64-224 [219977]
    Other proteins in same PDB: d4drra2
    automated match to d4ds0a_
    complexed with na

Details for d4drra1

PDB Entry: 4drr (more details), 1.5 Å

PDB Description: Cell attachment protein VP8* of a human rotavirus specifically interacts with A-type histo-blood group antigen
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4drra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4drra1 b.29.1.0 (A:64-224) automated matches {Rotavirus sp. [TaxId: 10970]}
tldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvldg
qtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagttpn
asesyyltinndnsnvscdaefyliprsqtelctqyinngl

SCOPe Domain Coordinates for d4drra1:

Click to download the PDB-style file with coordinates for d4drra1.
(The format of our PDB-style files is described here.)

Timeline for d4drra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4drra2